SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A107AGL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A107AGL9
Domain Number 1 Region: 3-121
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 4.84e-26
Family CobE/GbiG C-terminal domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A107AGL9
Sequence length 124
Comment (tr|A0A107AGL9|A0A107AGL9_9BURK) Cobalamin biosynthesis protein CbiG {ECO:0000313|EMBL:KWA62096.1} KW=Complete proteome OX=1503054 OS=Burkholderia stagnalis. GN=WT44_15725 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MQVALGLGFRAGVSAAQLDAAIRAALAHHPHARPAVVATLVDKSRARALRTLCARRGWPL
VAFDAAQLAAHPELAASAPSAAALARFGVAGVAEPCARLAAPHGRLLGPKFARGGVTVAF
AGPL
Download sequence
Identical sequences A0A107AGL9
WP_059806853.1.10281 WP_059806853.1.12949 WP_059806853.1.15137 WP_059806853.1.16416 WP_059806853.1.17026 WP_059806853.1.17777 WP_059806853.1.19852 WP_059806853.1.24468 WP_059806853.1.24730 WP_059806853.1.26768 WP_059806853.1.34193 WP_059806853.1.40304 WP_059806853.1.4361 WP_059806853.1.45040 WP_059806853.1.47735 WP_059806853.1.57018 WP_059806853.1.63278 WP_059806853.1.64011 WP_059806853.1.6653 WP_059806853.1.7154 WP_059806853.1.75530 WP_059806853.1.88794 WP_059806853.1.9553 WP_059806853.1.97338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]