SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A109UZ04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A109UZ04
Domain Number 1 Region: 201-319
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.2e-32
Family cAMP-binding domain 0.0000837
Further Details:      
 
Domain Number 2 Region: 324-439
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-30
Family cAMP-binding domain 0.00039
Further Details:      
 
Domain Number 3 Region: 5-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A109UZ04
Sequence length 455
Comment (tr|A0A109UZ04|A0A109UZ04_9SACH) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} OX=45286 OS=Eremothecium sinecaudum. GN=AW171_hschr42540 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Eremothecium.
Sequence
MSLSEEHRCVLERFQKDIEENNPGDILQFAANYFNRKLQEQREFVKKLESLALNKGITLF
PNNMEEDEHSGAAKSVTYDSSTNVADEEVVFKSPFIDHDPHSMHLCDTGDVSSQPSSGAR
LSSNTSDSGLFRANFSVRQESSSSAQHPLDPKESSYGEPSRKSVATPEPLPVNFNAERRT
SVSAETLKPANFNDWKLDSYTEKTREQLEGLAEAVGSNFLFKNLDPDSKLLIINSLKEKF
VKSGEEIIRQGDEGYYFYVVEKGTVVFYIDEKRVSTSGPGSSFGELALMYNSPRAATVVA
STDCKLWALDRLTFRRILLSRSFKKRLLYDEFLKSMPLLQSLTTYDRAKLADALDTEHYE
AGDKIICEGDSGENFYLIEYGEVDVIKEGKGVIAHLTKGDYFGEVALLNDLSRQATVVAT
TSTKVATLGKSGFQRLLGPAVEMLKVNDPTRSESK
Download sequence
Identical sequences A0A109UZ04
XP_017987634.1.1318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]