SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A113T548 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A113T548
Domain Number - Region: 97-146
Classification Level Classification E-value
Superfamily GINS helical bundle-like 0.0183
Family SLD5 N-terminal domain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A113T548
Sequence length 158
Comment (tr|A0A113T548|A0A113T548_PLABE) Uncharacterized protein {ECO:0000313|EMBL:CXJ24928.1} KW=Complete proteome; Reference proteome OX=5821 OS=Plasmodium berghei. GN=PBK173_000475300 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKDSEFVGGKLKLKGIKIKKTGNKKSDKKKHTQNEDKYDIKKKVDYDHSNRENYYNSNDE
NDGNNENNENNENNENDKNKKEKHKPEINFSNDDENIQELLKLNLTESEKAYQLVLKKRE
KQRMENFLKESYRQRLQKFNNNLASLSEHFDIPKVGPG
Download sequence
Identical sequences A0A077XJ21 A0A113T548 Q4Z3F1
gi|68072483|ref|XP_678155.1| PBANKA_144780 XP_678155.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]