SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A117E472 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A117E472
Domain Number 1 Region: 24-170,240-326
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 7.97e-41
Family Purine and uridine phosphorylases 0.0046
Further Details:      
 
Domain Number 2 Region: 939-1275
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.29e-31
Family Ankyrin repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 381-633
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000183
Family Extended AAA-ATPase domain 0.078
Further Details:      
 
Domain Number 4 Region: 736-811,856-873,912-1004
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000275
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A117E472
Sequence length 1300
Comment (tr|A0A117E472|A0A117E472_ASPNG) Unnamed protein product {ECO:0000313|EMBL:GAQ46312.1} KW=Complete proteome; Reference proteome OX=5061 OS=Aspergillus niger. GN=ABL_08973 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MEHQRPPPKRRKLDPGHSPQQLSHHDYTIGWVCALAIEAAAATAMLDEIHPALPIHPRDS
NSYTLGSIGRHNIVIACLPAGVYGTTSAATVASNMFISFRSIRHLLMVGVGGGAPSASTD
IRLGDVVVSIPTPRFEGVVQYDYGKTIGQGHFERTGTLNKPSTSLLTAVSNLRAADLRSG
SQIPALMSQMLARNPQMAETFTSPGCQRDLLFASDYGHDPAGPTCGFCDRKKLVSRSTRS
SDRPVVHYGLIASGNQVIKHAPTRDRLTAELNILCFEMEAAGLMDNFPCLVIRGVSDYSD
SHKNKDWQGYAAATAAAYAKQLLATIGACGPGPIPNPAVPGAITAVQHRASMIDALRFDQ
LESRQATIKPAHAKTCKWLLEKQEYVDWLDSNHFPEHRGFLWIKGKAGSGKSTMMKFAFL
QADATMDADTKVVSFFFNARGEDLEKSTLGMYRSLLVQLLEKLPELQALLDELDPKLWDE
KYPWCHEILQHILRKSISLLSGRRVICFVDALDECEEEEVRTMVDFIQSLGEHAISSSVQ
FHVCFSSRHYPHIAIDNGLELILEDQEGHADDITRYLRSELKIGRSKQAEDIRCEIQAKA
SGIFLWMVLVVQILNREFQRGRLHALRNRLREIPAKLSDLFKDILTRDTVNMGDLLLSIQ
WILFARRPLKREELYFAILSADPDNLAEAWDPEDITEQDIDRFILSTSKGLAETTKSKAK
TVQFIHESVRDFLLKENGLRQLWPEHQGNFEASSHNRLKQCCNNILLAKASNHIADEESI
ATASRDELKALWDSVSRRVPFLEYAVHNVLQHSEAAERGGIRQGCFLGNFNFPRWKHCSN
AFERYKSRRHTQSECLLHIVAKYDLSNLFRLICKDKPCGYIPSRRDLDFLVFYAVRSEIM
EFLDIINQNQLQDVTASPNACIEMALRCTIKFDRQAMFTNLLTNNRVDLNLPDKDGKQCL
HYVIQYGRDFMFNRILTMREIDLNAPDRDGDTPLHYTIQFDQNGMFSKLLTADNIASSVK
NKSGQTPVHYAVKYRRETMFNLLITRHRVDLTTSSFDAIEHNKSNRVSNFQSVSANRLEK
GDKEPLTLAFDRVNDTMTNPNLNISRINYRQGALSDEDWNSVLQYAAVTRWSKGVEPLIA
MDGSFPSLTRSCAEAVLLYAAWIGYKALVDKVLATGKADPNTKFIVDGMTALAYAASGGY
TEIARHLLSTEGIDVDAKNLQGATPLAHAASHGHTAIVNMLLSTGNVDPGSKDLSGYTPL
SRAVVNGHRDVVRQLLATGRVKVFSYSGNKMRWRWEGRTE
Download sequence
Identical sequences A0A117E472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]