SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A117SVK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A117SVK5
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0000000000183
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.01
Further Details:      
 
Domain Number 2 Region: 78-151
Classification Level Classification E-value
Superfamily PUA domain-like 0.000000000746
Family PUA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A117SVK5
Sequence length 159
Comment (tr|A0A117SVK5|A0A117SVK5_9CREN) Uncharacterized protein {ECO:0000313|EMBL:KUO92360.1} KW=Complete proteome; Reference proteome OX=1714261 OS=Thermocladium sp. ECH_B. GN=AT710_03680 OC=Thermoproteaceae; Thermocladium.
Sequence
MKTRDPYLIRRALTIISYEYGKGTVERLMGGDLSIEFNPVLNRVRQVYYNGELAFSIRAS
DGYLLPTLLGARFIDSYAVVRDEAVPFIRQGRNVPLSMVIDIINARAGMDIAIKDQSSNV
IGVGRLMVSPSELRGLGRGFIIRTRQHLGSHAPGDAVNR
Download sequence
Identical sequences A0A117SVK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]