SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A117T1V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A117T1V3
Domain Number 1 Region: 17-140
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.6e-29
Family VanY-like 0.0000606
Further Details:      
 
Domain Number 2 Region: 180-217
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.000085
Family Copper amine oxidase, domain N 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A117T1V3
Sequence length 226
Comment (tr|A0A117T1V3|A0A117T1V3_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KUP25033.1} KW=Complete proteome OX=1780103 OS=Paenibacillus sp. DMB5. GN=AWJ19_04915 OC=Paenibacillus.
Sequence
MLTLDQVKSKSAGWLGKLHPVLLAGASALIQRSYAKGIPIVITQGMRTIAEQNALYAQGR
TKPGNIVTNARGGSSYHNYGLAIDFALLLPDGKTVSWDTSRDGNNDKMADWQQVAQEAKK
LGFAWGGDWTSFKDYSHLEMTFGLTTEQLRAGRQPTVQQVKDALALINGTTGETDHAITV
TLNGVKITSGILDNGITYAPVRAVAEALGAQVTYDAASRTVNLVRE
Download sequence
Identical sequences A0A117T1V3
WP_068722688.1.74987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]