SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A118PIH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A118PIH0
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00693
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A118PIH0
Sequence length 72
Comment (tr|A0A118PIH0|A0A118PIH0_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KVN02526.1} KW=Complete proteome OX=1636424 OS=Burkholderia sp. MSMB1552. GN=WT08_24675 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
METRIQELEKATADIRERLARMESGLAHVATKADVMSVKTDVMSMEGTLLKWFIGTAIAL
AGLAFAAAKLIH
Download sequence
Identical sequences A0A118PIH0 A0A291CRT1
WP_006027238.1.11107 WP_006027238.1.1465 WP_006027238.1.15696 WP_006027238.1.1919 WP_006027238.1.20003 WP_006027238.1.20954 WP_006027238.1.22957 WP_006027238.1.23086 WP_006027238.1.23131 WP_006027238.1.2404 WP_006027238.1.28510 WP_006027238.1.30729 WP_006027238.1.30966 WP_006027238.1.32581 WP_006027238.1.33158 WP_006027238.1.37959 WP_006027238.1.39760 WP_006027238.1.50320 WP_006027238.1.50336 WP_006027238.1.55749 WP_006027238.1.56993 WP_006027238.1.57359 WP_006027238.1.59879 WP_006027238.1.66095 WP_006027238.1.68664 WP_006027238.1.74495 WP_006027238.1.75276 WP_006027238.1.77845 WP_006027238.1.82323 WP_006027238.1.82582 WP_006027238.1.84375 WP_006027238.1.85170 WP_006027238.1.85645 WP_006027238.1.86322 WP_006027238.1.8909 WP_006027238.1.91198 WP_006027238.1.94050 WP_006027238.1.94498 WP_006027238.1.96381 WP_006027238.1.98491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]