SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A120LUQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A120LUQ8
Domain Number 1 Region: 7-186
Classification Level Classification E-value
Superfamily VC0467-like 3.53e-54
Family VC0467-like 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A120LUQ8
Sequence length 187
Comment (tr|A0A120LUQ8|A0A120LUQ8_9SPHN) UPF0301 protein SGRAN_3470 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=267128 OS=Sphingopyxis granuli. GN=SGRAN_3470 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MESTPAWFTGQLLLALPGIGDPRFEQAVIAMISHDADGAMGIAVADPIDGMTVGAVLDQL
DIAHDDPLAQPVFLGGPVEPSRGFVLHSRDWGGEGAVQVADRWMLSSSHDILRAIGEGRG
PTRWLVALGYAGWSPGQLEDEMVRHGWHVTPGSDALLFETPPTRRWQAAFAEAGVDARLL
TTEGGEA
Download sequence
Identical sequences A0A120LUQ8
WP_067185767.1.60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]