SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A120N020 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A120N020
Domain Number 1 Region: 45-86,116-177
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 3.26e-24
Family Bacterial S-adenosylmethionine decarboxylase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A120N020
Sequence length 271
Comment (tr|A0A120N020|A0A120N020_HALHR) S-adenosylmethionine decarboxylase alpha chain {ECO:0000256|HAMAP-Rule:MF_00465} KW=Complete proteome; Reference proteome OX=1052 OS=Halorhodospira halochloris (Ectothiorhodospira halochloris). GN=HH1059_2187 OC=Ectothiorhodospiraceae; Halorhodospira.
Sequence
MDYSRIRLHGFNNLTKSLSFNIYDVCYAKTEAQRRDYIEYIDEEYNAERLTEILTNVAEI
IGANVLNVARQDYDPQGASVTILISEGPVSAEEAEECAEARPGPLPGDVVAHLDKSHITV
HTYPEMHPDKGVSTFRADIDVSTCGVISPLTALNYLIHSFDSDIVTMDYRVRGFTRDIEG
GKHFIDHEINSIQNYLSEDTKERYQTLDVNVYQENIFHTKMILREFDLDNYLFGESSADL
GDEEREQIRRNLRREMMEIFAGRNLPANQEV
Download sequence
Identical sequences A0A120N020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]