SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A121YH32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A121YH32
Domain Number 1 Region: 387-612
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.00000326
Family Rhamnogalacturonan acetylesterase 0.058
Further Details:      
 
Weak hits

Sequence:  A0A121YH32
Domain Number - Region: 275-331
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0379
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A121YH32
Sequence length 627
Comment (tr|A0A121YH32|A0A121YH32_HAEIF) Acyltransferase {ECO:0000313|EMBL:CWX22788.1} KW=Complete proteome OX=727 OS=Haemophilus influenzae. GN=ERS515279_01121 OC=Pasteurellaceae; Haemophilus.
Sequence
MSSIKYRPEIDGLRAIAVISVIIYHLNENWLSGGFLGVDIFFVISGFLITGIIITEIQQN
SFSFKQFYTRRIKRIYPAFITVMALVSFIASVIFIYNDFNQLRKTIELATAFLSNFYLGL
TQGYFDLSANENPVLHIWSLAVEEQYYLIFPLILILAYKKFREIKVLFIITLILFFILLA
TSFIPANFYKEVLHQPNIYYLSNLRFPELLVGSLLAIYHNLSNKVQLSKQVNNILAILST
LLLFSCLFLMNNNIAYIPGITLILPCIFTALIIHTTSQNNIIKLCLSNKAIVFIGKISYS
LYLYHWIFIAFAYYITGSKQIQGITVLIVVILTIIFSITSYYLIEQPIRKSKLNFKQAFI
YLYLIPSLFIIGYNTYERKQIRKEKEHIEQDVLSVNLENNFPTTVLTIGDSHAGHLTYFL
KYLGKQEGWKSTILSITDGKDCFVLVDKSNRITSECQELFDEINSPKYKAIFISGFYDLR
MGGQPVPRFNAESAIIPNFKIRFRETIKLLAKSKSVYIFANNSSISRSPIRGYLLEKYGL
EKYLEPIRRMGDIDASNKIIHDLIKDIPNVYWVDAQQYLPKDSVMAEGKYLYGDQDHLTN
FGAYYMAKEFSKYQRVMTPEQVKKLYE
Download sequence
Identical sequences A0A121YH32
gi|543952731|ref|YP_008544805.1| WP_021035664.1.20644 WP_021035664.1.28719 WP_021035664.1.97818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]