SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A124GQV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A124GQV9
Domain Number 1 Region: 339-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000531
Family Extended AAA-ATPase domain 0.075
Further Details:      
 
Domain Number 2 Region: 1234-1331
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000955
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A124GQV9
Sequence length 1503
Comment (tr|A0A124GQV9|A0A124GQV9_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KUM59347.1} KW=Complete proteome; Reference proteome OX=48697 OS=Penicillium freii. GN=ACN42_g7803 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MDIETQSLWMTAKAKLDKVDQNLLDFESDDGIKRTRENELDILESLEKTTREAYDTCIRK
RWHIPIPGKGKKIIIRDLLRKVAHWIELFKTVGDQVVQYDPGHAALPWAGARFLLQIAIN
DFGKFDFVVQGAERIARMTARYRTIEQIYANKGSAASEQLEEAVVRVYGSILKYLVEAKR
YFEHKTGGELILQISIVARESSKSLVRLLKSGLLGQNDFQDLLEKMEADERLVDRCANLV
QVNNDITSHLATLSLERETFHSLRDTLSRVTQPISQVSLHLNKFDDHLDSIQRRQMLDWL
STQPYLDHHTTIKLRVLDGTCQWVLQHPGFTEWKSESINSLLWLHGAQGTGKTCLASVVI
DDGMDVSSQIEDFAHAYFYCSRSTAEHQRGNAQSILGCIARQLSSPTSNQPLASPTLSLY
RKIHLADGSTRAPSLWECRDLILELTEAYSRTTIVIDALDECAREERAELVEALEYIIDN
STSLVKAFVTSREEGDLRLSIQEHTGVQVTWVENGSDIEKFVNFETDRLVEKNQLLGSIR
VKSTKEELRALIKEDTIYKARGMFRWAQLQLQSLRWIRMERDIRFAMSTIPRPLSELYED
LYTKALEITEETDQALFRNTLKWMLCTTRVLDWEDFSQAITSFVEIQVHEIDEEFILDLL
GNFVISQTTQEGNRTFRFAHLSVREFLETKPEYSTESSNTFAAEVCLLKLIQASGSPSAE
QFLGRMGLSDQGTVTLSEIDSYRKGIHDYSLRNWNVHCVRAGEVNRSDEELHLFHLLRYF
LFDDSDSNCPLKCWVHSRQRRKMEGVRGEHLLQLLHNYHRSRDRGVLLSCVFGFGEVLRT
NHYHELDDDVKEACILAAVKHSQYYIWEYLMGETKGRLPQKRVLSALVENGDIEPLKLFL
TLTEPDLITVPVILDAHWAGTEIIGLLLDHNKNLHITTELIEESRLPYSAIEAFLSRSPD
ILITSEILKNVIADIPIAHLREILDKNGGSIITCEVIASASYYGYRNGMQAKTELLLECA
GQIKGTERAMIQAVSSRENSEVLEILLNHGWPVTENVMVRAATRGTVAPFELMLKAGGPI
TSKVIVGGARNVSDGARMVKLLVSLMNGPLDDELWVQMMLECAQNTWGNPETLQVLLEMK
PGLKVSEEILIACTENSIKGSIILGVILEDNREMQVTDAVILNALKKLDYDETISKLLDL
HGSTNISSQMLFGAAQNYRFADEMTKLLLQRTATIEKPSSMVVDAVIGNRYSGYKILHML
ESRFGQLDLCEANVETAAESGNHAMLNLVLDRCSITEATPSVLLAAAAKGSLEVMKHLLK
LDNAVVTEEILIAASGNPGCSMDMLRVLWKFAPHIKVCPEMFLNAGDPTDVEFLFSRVKD
SQMCQDILNAVMAEKKTPNCWPDWVSVPTLNLIFESEFEIGVTDELVIDTLKAGRGWLLK
TLFTHRRDIELSQDMVNTTVALAVELEDYQLLQVLVKYGNSRGLDLHDARVILDNFLWGF
SEE
Download sequence
Identical sequences A0A124GQV9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]