SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A124K274 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A124K274
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily BH3703-like 0.00000000288
Family BH3703-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A124K274
Sequence length 114
Comment (tr|A0A124K274|A0A124K274_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:KUY21248.1} KW=Complete proteome OX=1756148 OS=Elizabethkingia genomosp. 2. GN=ATB95_10210 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MTVDEIYLLIAQNIANSVQSENWNKATLNIQGDDTYVDTTGEYLDSNNVAQSLDVHNFDA
DVDFAIMELHEITTEGGNNKWNKAIFTLTPDGDFDMEFIWDQELQNEIDRLANE
Download sequence
Identical sequences A0A124K274
WP_059344781.1.40236 WP_059344781.1.70044 WP_059344781.1.72590 WP_059344781.1.98752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]