SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A124P9T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A124P9T8
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily MbtH-like 2.09e-25
Family MbtH-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A124P9T8
Sequence length 68
Comment (tr|A0A124P9T8|A0A124P9T8_9BURK) Protein mbtH {ECO:0000313|EMBL:KVE29559.1} KW=Complete proteome; Reference proteome OX=1503053 OS=Burkholderia singularis. GN=WS67_04685 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
MTSLLDDPDGVFQVLINGAGQHSLWPAELPIPQGWHKAFGDDTRQACLDYVEARWTDLRP
RGVAANGT
Download sequence
Identical sequences A0A124P9T8 A0A1B4QXL0
WP_059513554.1.37738 WP_059513554.1.50573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]