SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A124PEG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A124PEG1
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily MbtH-like 8.63e-28
Family MbtH-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A124PEG1
Sequence length 82
Comment (tr|A0A124PEG1|A0A124PEG1_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KVE44149.1} KW=Complete proteome OX=1385591 OS=Burkholderia sp. BDU6. GN=WS70_08350 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
MSWGDENTVYDVVVNHEEQYSIWPTYKSLPAGWRTAGKQGSKAECLSYIDEVWVDMRPLS
LRRAMEASTQADDTPSTAPTTH
Download sequence
Identical sequences A0A124PEG1
WP_059474104.1.62311 WP_059474104.1.72075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]