SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A125JSS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A125JSS0
Domain Number 1 Region: 32-164
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 1.16e-52
Family Ecotin, trypsin inhibitor 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A125JSS0
Sequence length 166
Comment (tr|A0A125JSS0|A0A125JSS0_9BURK) Ecotin {ECO:0000313|EMBL:KWK70707.1} KW=Complete proteome OX=101571 OS=Burkholderia ubonensis. GN=WM15_04020 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MKFAIRAALAAICVTSAAACAAGPASEAAVTAESIKMFPQASAGQQRAVIALPALADEAG
ARVELMIGKTLQTDCNQQWFGGELSAETVQGWGYTYYRLSDVKGPASTMMACPGQAPRER
FVQVRGDDQLLRYNSRLPIVVYVPDGFEVRYRVWRASDDVKRAVVQ
Download sequence
Identical sequences A0A125JSS0
WP_060190000.1.23510 WP_060190000.1.50481 WP_060190000.1.93286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]