SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A125SE61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A125SE61
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.7e-36
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A125SE61
Sequence length 145
Comment (tr|A0A125SE61|A0A125SE61_9ARAC) Putative AP-2 complex subunit mu {ECO:0000313|EMBL:AME21613.1} OX=407818 OS=Stegodyphus africanus. GN= OC=Araneae; Araneomorphae; Entelegynae; Eresoidea; Eresidae; Stegodyphus.
Sequence
DISFPFRIIPLVREVGRTKMEVKVVLKSNFKSSLIGQKIEVRIPTPLNTSGVQLICMKGK
AKYKASENAIVWKIKRMAGMKETQLSAEIELLQTDTKKKWNRPPISMNFEVPFAPSGLKV
RYLKVFEPKLNYSDHDVIKWVRYIG
Download sequence
Identical sequences A0A125SE52 A0A125SE53 A0A125SE54 A0A125SE55 A0A125SE56 A0A125SE57 A0A125SE58 A0A125SE59 A0A125SE60 A0A125SE61 A0A125SE62 A0A125SE63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]