SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A125Y0M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A125Y0M8
Domain Number 1 Region: 27-157
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 8.37e-50
Family Ecotin, trypsin inhibitor 0.0000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A125Y0M8
Sequence length 160
Comment (tr|A0A125Y0M8|A0A125Y0M8_AERCA) Ecotin {ECO:0000313|EMBL:KOG92448.1} KW=Complete proteome OX=648 OS=Aeromonas caviae (Aeromonas punctata). GN=AL345_13595 OC=Aeromonadaceae; Aeromonas.
Sequence
MKTVLRFSLLGALLLGGHAFAAEPKKFDISMFPAAEVNQERVVIRLPEVENEADMMVELQ
VGKKMLVDCNLPRFAGNLEQHSVKGWGYNYLTLGQVTGPVSTLMACPDGQKKESFVQIYG
QGFFVNYNSKLPFVIYVPQEYEVRYRLWRADNLAQPAMIE
Download sequence
Identical sequences A0A125Y0M8 A0A1M3I543
WP_010674240.1.59266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]