SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A125YIL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A125YIL4
Domain Number 1 Region: 218-377
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 0.00000000000107
Family Guanido kinase catalytic domain 0.0066
Further Details:      
 
Weak hits

Sequence:  A0A125YIL4
Domain Number - Region: 96-169
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 0.000589
Family Guanido kinase N-terminal domain 0.0076
Further Details:      
 
Domain Number - Region: 11-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0575
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A125YIL4
Sequence length 415
Comment (tr|A0A125YIL4|A0A125YIL4_TOXGV) ATP:guanido phosphotransferase, carboxy-terminal catalytic domain protein {ECO:0000313|EMBL:ESS35717.1} KW=Complete proteome; Reference proteome OX=432359 OS=Toxoplasma gondii (strain ATCC 50861 / VEG). GN=TGVEG_231605 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MADRQRTKEQEDIRHYCETQQLPQLLALLLNRLAQKKDPHPKLFAVKYFADRVSDSDLGT
IGLYRSAPTGQNASCPATGAKDLVDGDDVRFQNPYQADKRSWMRNNIAPDAWLQLGEVRT
SKGLSALQCLLPNDEDDRDGNEFSIDADSGIIALSVECYESFHLLFSEFLRFSDATLMAK
SIFVIPSYPLDAMNERVPAVLPSLTMHSSLRNLLLCFHRNFASFAFPPTMTLAESNKVID
RVQKGINKWLMTKVNSGFGPPDIEMCRGPDLFRRRGQLFRALQSEGALPSQGTYLDGVNP
HRATALWLSPDKKVIVQVNWRNHLRIEVKISNPFDASEIVQGFQSAYSLLDCMKEKEEEP
FAKHKDFGYLTVDPLDCRLGFTSVVAKCTKSDQLSICSWEQESTLGGRIHQSYQL
Download sequence
Identical sequences A0A125YIL4 S8EZW5
XP_018636841.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]