SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A127S7G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A127S7G0
Domain Number - Region: 26-78
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 0.00432
Family Variable surface antigen VlsE 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A127S7G0
Sequence length 128
Comment (tr|A0A127S7G0|A0A127S7G0_RALSL) Type III secretion protein HrpB2 {ECO:0000313|EMBL:AMP39842.1} KW=Complete proteome OX=305 OS=Ralstonia solanacearum (Pseudomonas solanacearum). GN=LBM2029_19865 OC=Burkholderiaceae; Ralstonia.
Sequence
MIQGPTSVPPIATHPVDAPALPAVQQEPVQELVSRFEALLGSAKDARRHSKGPSAIGELV
AKEDAAVRATADRINATLETDKVKPMEEILVDAMRIQMEAAATMTKIHMGSMVAHSGKNA
VQTLMKNQ
Download sequence
Identical sequences A0A127S7G0 A0A1U9VLZ1 D8N0K9 G2ZXZ7 G3A9M9
WP_013209871.1.13478 WP_013209871.1.26805 WP_013209871.1.29177 gi|300693813|ref|YP_003749786.1|NC_014310 gi|300693813|ref|YP_003749786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]