SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A128IEZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A128IEZ1
Domain Number 1 Region: 3-344
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 1.09e-94
Family Pseudo ankyrin repeat 0.000000000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A128IEZ1
Sequence length 368
Comment (tr|A0A128IEZ1|A0A128IEZ1_LEGPN) Uncharacterized protein {ECO:0000313|EMBL:CZG32617.1} KW=Complete proteome OX=446 OS=Legionella pneumophila. GN=ERS240541_00515 OC=Legionellaceae; Legionella.
Sequence
MYNLTIHNLENYEKDPKIRLIPWALWENLFQHFISVYELSLMTLSYKEAIHIFLPKTKNK
EQLRQLLCLYYAHFDRNDKQFWCDVHKKGIKSEVICCAAAITGCSSALDTISLSLIPDEI
VKMIQAENYYAFRLAAENGHLHVLNRLCELAPTEVMAMIQAENYHAFRLAAENGHLHVLN
RLCELAPTEATAMIQAENYYAFRWAAVGRGHHNVINFLLDCPTMLGYAEMHEFEYGEKYV
NPFIVRHVNRLKEMHDAFKQSNPEALFDLVTKSECLQGFYMLRNLIRRNDEALLDDIRFL
LSIPGIKALAPAGTIPGNENELLRLALRLGNQGACALLLSIPSVLALTKANNYYIDEAWG
RLDLRAVA
Download sequence
Identical sequences A0A128IEZ1
WP_061690676.1.13050 WP_061690676.1.29717 WP_061690676.1.38133 WP_061690676.1.48466 WP_061690676.1.50306 WP_061690676.1.62255 WP_061690676.1.8407 WP_061690676.1.94483 WP_061690676.1.95613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]