SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A131X9X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131X9X5
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.46e-34
Family Frizzled cysteine-rich domain 0.0000928
Further Details:      
 
Domain Number 2 Region: 127-229
Classification Level Classification E-value
Superfamily TIMP-like 0.00000196
Family Tissue inhibitor of metalloproteinases, TIMP 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A131X9X5
Sequence length 234
Comment (tr|A0A131X9X5|A0A131X9X5_9ACAR) Putative secreted frizzled-related protein 5 {ECO:0000313|EMBL:JAP63619.1} OX=257692 OS=Hyalomma excavatum. GN= OC=Hyalomma.
Sequence
IGYTRMRLPNLLEHDSMAEVQQQARSWVQLVNRRCHPDTQLFLCSLFSPVCLERPIFPCR
SLCEAVRRGCEATMTHYGYPWPDMVRCDKFPLDNDMCIGVQSTAAASEASASAACRACQQ
ANTTESLVDNYCRADFVVRARVKRLQGSQLQCKRSKLLKLREGLPRRQLRRPVLKAPDFE
RCCGPLKGQLLLMGLRAENGSLAPLLIMPWRRTTAFRKALRLMRGVDCANPLQH
Download sequence
Identical sequences A0A131X9X5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]