SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A131XF48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131XF48
Domain Number 1 Region: 13-147
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 2.48e-58
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000000204
Further Details:      
 
Domain Number 2 Region: 282-425
Classification Level Classification E-value
Superfamily L30e-like 5.38e-54
Family ERF1/Dom34 C-terminal domain-like 0.000000861
Further Details:      
 
Domain Number 3 Region: 148-280
Classification Level Classification E-value
Superfamily Translational machinery components 4.8e-50
Family ERF1/Dom34 middle domain-like 0.000000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A131XF48
Sequence length 441
Comment (tr|A0A131XF48|A0A131XF48_9ACAR) Putative peptide chain release factor 1 erf1 {ECO:0000313|EMBL:JAP64748.1} OX=257692 OS=Hyalomma excavatum. GN= OC=Hyalomma.
Sequence
MASTGYNLEESNADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVSKMLADE
FGTASNIKSRVNRLSVLGAITSVQHRLKLYTKVPPNGLVIYCGTIVTEEGKEKKVNIDFE
PFKPINTSLYLCDNKFHTEALSALLADDNKFGFIVMDGNGALFGTLQGNTREVLHKFTVD
LPKKHGRGGQSALRFARLRMEKRHNYVRKVAEVATTLYISNDRPNIAGLILAGSADFKTE
LSQSDMFDPRLQVKVLKLVDVSYGGENGFNQAIELSAEVLSNVKFIQEKKLIGRYFDEIS
QDTGKYCFGVEDTLKALEMGSVEILIAWENLDIVRYVLKNHTSDEEKILHLTPEQEKDKT
HFLDRETGVELELVESMALLEWLANNYKNFGATLEIITDKSQEGSQFVKGFGGIGGILRY
RVDFQSLEVNDLVDDFDLDDL
Download sequence
Identical sequences A0A131XF48 A0A131YRA9 A0A224YVI4 L7MAT6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]