SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A131XZL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131XZL3
Domain Number 1 Region: 119-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-34
Family cAMP-binding domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 248-373
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-30
Family cAMP-binding domain 0.00000231
Further Details:      
 
Domain Number 3 Region: 13-60
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.83e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A131XZL3
Sequence length 381
Comment (tr|A0A131XZL3|A0A131XZL3_IXORI) Putative camp-dependent protein kinase type i-beta regulatory subunit {ECO:0000313|EMBL:JAP71061.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
ESKMASTQEEEQSLRECELYVQKHNIQKLLKDCIVQLCVSRPDNPVSFLREYFARLEKEA
ATKAKQQQLSPMATTPPGEAREDELSPLPVPPQRNRRGAVSAETYSEEDATSYVKKMVPK
DYKTMAALSKAIEKNVLFSHLDDNERSDIFDAMFPVVHRAGEVIIQQGDEGDNFYVLDQG
EVDVYVNGQLVTTIAESGSFGELALIYGTPRAATVKAKTDVKLWAIDRDTYRRILMGSTI
RKRKLYEEFLSKVSILESLDKWERLTVADALEPVTFNDGDVIVEQGMPGDDFFIIEEGSA
SVLQRRSESEPQEEVGRLGPSDYFGEIALLLDRPRAATVVSRGNLKCVKLDRSRFERVLG
PCAEILKRNMTHYNSLISLSV
Download sequence
Identical sequences A0A131XZL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]