SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A131Y6Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131Y6Y7
Domain Number 1 Region: 24-84
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000693
Family ATI-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A131Y6Y7
Sequence length 94
Comment (tr|A0A131Y6Y7|A0A131Y6Y7_IXORI) Putative serine proteinase inhibitor {ECO:0000313|EMBL:JAP74597.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
LLLSGFLVLLAATAASARIPPQLPWVCGPREVFKTCVSSSCAELKCGMERMPLACTKDCA
SGCFCAPGFYRRGHRECVPRSECQIEPLKPMPKA
Download sequence
Identical sequences A0A131Y6Y7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]