SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A131YSH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131YSH0
Domain Number 1 Region: 454-511
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000127
Family ATI-like 0.053
Further Details:      
 
Domain Number 2 Region: 329-383
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000288
Family ATI-like 0.045
Further Details:      
 
Domain Number 3 Region: 201-256
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000111
Family ATI-like 0.062
Further Details:      
 
Domain Number 4 Region: 261-320
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000034
Family BSTI 0.071
Further Details:      
 
Domain Number 5 Region: 392-447
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000615
Family ATI-like 0.027
Further Details:      
 
Domain Number 6 Region: 75-116
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000942
Family ATI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A131YSH0
Sequence length 518
Comment (tr|A0A131YSH0|A0A131YSH0_RHIAP) TIL domain containing protein {ECO:0000313|EMBL:JAP82183.1} OX=34631 OS=Rhipicephalus appendiculatus (Brown ear tick). GN= OC=Rhipicephalus; Rhipicephalus.
Sequence
MIDSRPKGDSLFLKCKRSGPVTLSTVMAVKQILDTLSIPGSIMLLLGVVTARSQHTGISH
ECSSLEVPVIDGIPRTDLFCKPELASFTEIYKQRYCLCKAGYIRNAWGQCVRLEECYGCH
FTANADFSPCSSACPHICGLPTPANCTKQCVSGRACAPGFVRFGTMVIDGTTDWTDIHAL
HKTSPNGPCISLSLCVQSCLGPHQMYTTCSPLCPLTCENPEPRWCPPSCGGYRCVCQPGY
VALTYDPLVCIPPDQCPDRNVTCPGLNQRYTTCKPRCPTTCFDNRRHPCMTQCGGRGCVC
SRGYVQLQEDPLVCVRRQECPPRPKCPGRGQAYTTCLSHCPETCLDTKPRICPAVCAGEG
CQCDKGFVQLQADPLICVRKKECPSHPRLCQGPNQVFTDCKSRCPATCSESKPSVCPTGC
DGQGCVCKEGYVQLQAIPLICVRRKYCPIVPKVCPVSNQEYTSCKSTCPLTCAQKLPRMC
TSKCAGDGCVCKQGYVQLRDEPLTCVPRDECPSKHRAF
Download sequence
Identical sequences A0A131YSH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]