SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A131YT11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131YT11
Domain Number 1 Region: 132-205
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 4.06e-31
Family AN1-like Zinc finger 0.00018
Further Details:      
 
Domain Number 2 Region: 14-57
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000214
Family A20-like zinc finger 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A131YT11
Sequence length 210
Comment (tr|A0A131YT11|A0A131YT11_RHIAP) Zinc finger protein {ECO:0000313|EMBL:JAP81051.1} OX=34631 OS=Rhipicephalus appendiculatus (Brown ear tick). GN= OC=Rhipicephalus; Rhipicephalus.
Sequence
MERDTNQMSQSGALCRSGCGFYGSPATDGLCSQCYKDALKRKQTAGRGSPTVMSSLGLAA
SSSSSSSESASSASVAAVSDPALNTASPTVPPVLASTSQDAAVSEACCLLQKADLNLDAC
GAPSKSTESVTSETGSQQDDQKDQKKKKNRCRICRKKVGLTGFQCRCGGLFCSLHRYSNE
HDCTFDYKEMGAQEIRKNNPVVVGDKIQKI
Download sequence
Identical sequences A0A131YT11 A0A224ZBJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]