SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132A2P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132A2P6
Domain Number 1 Region: 107-230
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-33
Family cAMP-binding domain 0.0000241
Further Details:      
 
Domain Number 2 Region: 240-303
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-18
Family cAMP-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A132A2P6
Sequence length 308
Comment (tr|A0A132A2P6|A0A132A2P6_SARSC) cAMP-dependent protein kinase type II regulatory subunit-like protein {ECO:0000313|EMBL:KPM04875.1, ECO:0000313|VectorBase:SSCA003106-PA} KW=Complete proteome; Reference proteome OX=52283 OS=Sarcoptes scabiei (Itch mite) (Acarus scabiei). GN=QR98_0033290 OC=Sarcoptoidea; Sarcoptidae; Sarcoptinae; Sarcoptes.
Sequence
MSHPNYEIPPELNSLLIDFTVSVLVHRPPDLIEYSANYFNRLLNDRRSSAPGNHSFQGNH
CNEDDNDSNSSDIKPPARLSFTRRKSVFAEHYDPEEDEGETEQIFYPKSDAQRRCLSEAI
KNILLFRSLEPSEMSELIDAMFERKVEANEVVIKQGDDGDYFYVIADGTFSITVANGDGT
EKEVGKYTGSGSFGELALMYNMPRAATVHATTKGSLWAMSRQTFRRIVLKRAFMKRKEYE
SFIEKGDQADGMYFVQEGFVRIVKEKENGQEQELSRLDKGGYFGELALITKKPRAASAYA
ASPESWMF
Download sequence
Identical sequences A0A132A2P6
SSCA003106-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]