SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132NN93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132NN93
Domain Number 1 Region: 341-375
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000157
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A132NN93
Sequence length 379
Comment (tr|A0A132NN93|A0A132NN93_GIAIN) Uncharacterized protein {ECO:0000313|EMBL:KWX11547.1} KW=Complete proteome OX=1394984 OS=Giardia intestinalis assemblage B. GN=QR46_4486 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MTSSASNSDDIDNLNEEQANISMDQPPNPQDLVYEEPDNVAIDENGNLQQDFIDDLEVDN
SPEKPIDEDPTKGSMNPEEVDDNNPEQEDDASVLEAELLDDDSIVYAPEDLIDEGNAQPL
ESLGALTEDRCALASAEGYQNVDALFDAQAPDPLEDPDVGGLSDINDPARASVNSAYTAE
DHIEAEELVVVNVDHDPVQQEGITASATLDTSAIVPTEDPGQQLCPADHPQVSEPKENED
TFENDVVVEQSPGLQTNICEESIDPNMHPAIAQAIRTRNXPFPLLDDPKLPHTRENFNLP
PLVEGHSVPVDKGTYQDYIFDLERQEYLQKEEVTKAHTEYLERHHELKQIVSDFLTSILI
DKPSDVYQYAADYFSVAVN
Download sequence
Identical sequences A0A132NN93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]