SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132NNB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132NNB8
Domain Number 1 Region: 13-67
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000144
Family Preprotein translocase SecE subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A132NNB8
Sequence length 74
Comment (tr|A0A132NNB8|A0A132NNB8_GIAIN) Sec61-gamma/ SecE {ECO:0000313|EMBL:KWX11577.1} KW=Complete proteome OX=1394984 OS=Giardia intestinalis assemblage B. GN=QR46_4471 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MSRGNANEGLMTRAKGEIASMRRFWNGCDKPTPEEVKKLVVSAGMGIIAIGVTGFAIKTI
SYPIFRLLSGASMV
Download sequence
Identical sequences A0A132NNB8 C6LP45 V6TRD0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]