SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132NYU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A132NYU9
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.022
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A132NYU9
Sequence length 239
Comment (tr|A0A132NYU9|A0A132NYU9_GIAIN) Uncharacterized protein {ECO:0000313|EMBL:KWX15238.1} KW=Complete proteome OX=1394984 OS=Giardia intestinalis assemblage B. GN=QR46_0777 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MRHLLLLRPADPYDFLYKYYKTLAQESIPIKLILDAVSELPLDAVDVFCLYMSRLYSILK
DNPVYIEGICNASSHYVLTNKLVDEGGRLLLSQTSMHKLLPLCMVQNVQIVDFSLFLAKT
RAAFVINRVVRLLYSTLQDLSINGRVPETATKVLTHYIPMAQSFSLSFLPPSSLEIDTEL
HMDAGSGEKGGQTVESVMEALVKLILRTDSLLVHCDTDDRYEKTDLQLIHVASDFWGMI
Download sequence
Identical sequences A0A132NYU9 C6LYT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]