SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132NZC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132NZC0
Domain Number 1 Region: 18-290
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.68e-48
Family Ankyrin repeat 0.00015
Further Details:      
 
Weak hits

Sequence:  A0A132NZC0
Domain Number - Region: 276-303,389-441
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.051
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A132NZC0
Sequence length 505
Comment (tr|A0A132NZC0|A0A132NZC0_GIAIN) Protein 21.1 {ECO:0000313|EMBL:KWX15418.1} KW=Complete proteome OX=1394984 OS=Giardia intestinalis assemblage B. GN=QR46_0512 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MVVNRPIFSFQKVVKTMSSNIYTALMEAARKGDMAALRQNMRQQARLKDNLGVTALMYAA
QAGRYEAVSLLAEYEAGMQDWRGKTALITAIQNGHAEVARLLVPYEAGLRDTDGATALMS
AASMGFSGLIQELLEKELKCVDDNGKTALMYAAESNQVDAVKILLKHEAGIRDASGQTAM
MYATVSGNISVIELLLSYEAGICKDNGWSCLMTAAKLGNFEAAELLASKEACLAKQNGMT
ALMVAAQFDHEDIVRLLMAAEGNMVRKDGLSARNIASQFGNHEIADILASSTHLFHPINP
PTSVGRSRSVNEPKAEHDLSKAFTSSNLMPPQRYQHPHATPSHVSTTPTTRGAARREGQQ
GPVVYSTPALIESNHTSSHPDGNSSKLVESYILSEASQFDNITLNATLMDSVQSGHSAPN
NSKILKLLTDIDCKDCEIDALKKQVTQLQNQLSRKADGLVDIKADYLSQARQLQRMAEYM
LEFANEIEPGINYMSSNTTQKSETQ
Download sequence
Identical sequences A0A132NZC0 V6U0Y4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]