SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132Z9F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A132Z9F8
Domain Number - Region: 364-400
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A132Z9F8
Sequence length 400
Comment (tr|A0A132Z9F8|A0A132Z9F8_ENTFC) Type I restriction modification site-specific deoxyribonuclease HsdR {ECO:0000313|EMBL:SAM53840.1} KW=Complete proteome OX=1352 OS=Enterococcus faecium (Streptococcus faecium). GN=AS238_05715 OC=Enterococcus.
Sequence
MCTKLLQNTAHKNPYKTVDEATQLDLVIVVNQLLTGYDSKWVNTLYLDKSLEYQNIIQAF
SRTNRLNGPEKPFGTIRYYRKAHTMEQNIEEAIELYSGKQAKGLFVEKLYNNLEKLNDIF
EEIKSVFNISGIENFSHLPEVPGEIKQFVNLYNQLIHCYESAMIQGFTWAKSTYEIQDYE
PITVVITEYEFNILAQRYSEIEREPRDGNDSIAYDIDYQLPEGSRSRINYEYLNTNFKKY
MNIKEERDSNLIQSLLNDLHRTFAQLPVELQPYAEMILNDVNNGELVIKEGWEFTDYLNE
YQLSEEDDFIQDLVDSTNINEALLREMLDLRLTEVNINEYSRFDKLKSSVNVGHFSGYIE
KNLGKMVIPIKVNMLIDRLLRAFLLEDVFDVTEYIKNYFN
Download sequence
Identical sequences A0A132Z9F8 Q3XZ09
WP_002288612.1.100305 WP_002288612.1.10380 WP_002288612.1.10519 WP_002288612.1.13042 WP_002288612.1.15013 WP_002288612.1.15879 WP_002288612.1.17607 WP_002288612.1.19708 WP_002288612.1.19916 WP_002288612.1.23429 WP_002288612.1.24789 WP_002288612.1.25648 WP_002288612.1.26561 WP_002288612.1.2657 WP_002288612.1.2798 WP_002288612.1.28359 WP_002288612.1.29053 WP_002288612.1.29641 WP_002288612.1.34701 WP_002288612.1.35158 WP_002288612.1.37318 WP_002288612.1.3938 WP_002288612.1.40180 WP_002288612.1.4198 WP_002288612.1.44585 WP_002288612.1.45650 WP_002288612.1.46020 WP_002288612.1.47945 WP_002288612.1.49384 WP_002288612.1.5246 WP_002288612.1.5286 WP_002288612.1.56694 WP_002288612.1.64252 WP_002288612.1.65170 WP_002288612.1.67518 WP_002288612.1.72952 WP_002288612.1.73077 WP_002288612.1.75235 WP_002288612.1.76730 WP_002288612.1.79859 WP_002288612.1.80238 WP_002288612.1.81222 WP_002288612.1.81636 WP_002288612.1.81642 WP_002288612.1.81958 WP_002288612.1.82658 WP_002288612.1.83339 WP_002288612.1.8382 WP_002288612.1.83988 WP_002288612.1.85739 WP_002288612.1.87637 WP_002288612.1.88065 WP_002288612.1.90494 WP_002288612.1.9415 WP_002288612.1.94185 WP_002288612.1.94314 WP_002288612.1.94583 WP_002288612.1.95538 WP_002288612.1.98407 WP_002288612.1.99032 WP_002288612.1.9948 YP_006377501.1.11553 gi|389869951|ref|YP_006377501.1| gi|389869951|ref|YP_006377501.1|NC_017963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]