SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A133JZM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A133JZM2
Domain Number 1 Region: 82-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000418
Family NfeD domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A133JZM2
Sequence length 141
Comment (tr|A0A133JZM2|A0A133JZM2_9ACTO) Nodulation efficiency protein D {ECO:0000313|EMBL:KWZ72681.1} KW=Complete proteome OX=33007 OS=Actinomyces neuii. GN=HMPREF3198_01708 OC=Actinomyces.
Sequence
MSGWIWVGAALLGVIVELLSGDFFFLMLAIGAGASGVSAFLAPELWWLHILLFAAVSSVL
VLTVRPFLKKRIESSTPKVAFNASRYRGRCGVATSSINSAGGTIMLHGERWSAVSEEPIN
EGETVTVVRIDGARAVVKTTD
Download sequence
Identical sequences A0A133JZM2 A0A1F1WZR2
WP_024332223.1.14193 WP_024332223.1.43908 WP_024332223.1.63534 WP_024332223.1.72087 WP_024332223.1.88947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]