SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A133PRM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A133PRM9
Domain Number 1 Region: 49-131
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 1.24e-23
Family Copper amine oxidase, domain N 0.011
Further Details:      
 
Domain Number 2 Region: 187-230
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.000000131
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A133PRM9
Sequence length 231
Comment (tr|A0A133PRM9|A0A133PRM9_9FIRM) Copper amine oxidase domain protein {ECO:0000313|EMBL:KXA31467.1} KW=Complete proteome OX=54005 OS=Peptoniphilus harei. GN=HMPREF3229_00455 OC=Peptoniphilus.
Sequence
MKKQKNLFLIALLFVIFMPLNSFANSDIKLWINGDYVSTDVPPVIENGRTLVPLRVVSEN
LGLAVDWNGDLKQITISKDDEQFIFLIGQNFFQKGDSKQDLDVAPKIVDGRTLVPIRVIA
EAFGQEVTWDNLARTVAIGSGYQVQQNPTPPVVDVKPKVTEVKKVVSNPNGTNNYQNYIT
DTSQGKIKGNKNSKIYHVPGGRDYNKVSQKNVVFFNTEQEAQAAGYRRAKQ
Download sequence
Identical sequences A0A133PRM9
WP_060799735.1.80040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]