SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A133V8B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A133V8B6
Domain Number 1 Region: 82-173
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 3.14e-33
Family tRNA-intron endonuclease catalytic domain-like 0.0000576
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 0.0000000000844
Family tRNA-intron endonuclease N-terminal domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A133V8B6
Sequence length 178
Comment (tr|A0A133V8B6|A0A133V8B6_9EURY) Uncharacterized protein {ECO:0000313|EMBL:KXB02698.1} KW=Complete proteome; Reference proteome OX=1698273 OS=candidate divison MSBL1 archaeon SCGC-AAA261D19. GN=AKJ43_00910 OC=Archaea; Euryarchaeota; candidate division MSBL1.
Sequence
MENEVPEAYYFNKRIIVPEEEEANRIHERGATGKPLSGGGLQLAPVEALYLLEREKIKII
SKEEGETLSFDDFFSKFSDIDPELMFKYIVYQDLRSRGYVVKTGLKYGAHFRVYERGVTP
GTDHSAYLVHAISENENLTPHDLSRAVRLAHSVRKKMIFAVIDNEGDVTYYSLTRETP
Download sequence
Identical sequences A0A133V8B6 A0A133V9G4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]