SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A133X096 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A133X096
Domain Number 1 Region: 68-188,226-371
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 2.09e-19
Family Pseudo ankyrin repeat 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A133X096
Sequence length 779
Comment (tr|A0A133X096|A0A133X096_LEGPN) Ankyrin {ECO:0000313|EMBL:KXB24358.1} KW=Complete proteome OX=446 OS=Legionella pneumophila. GN=PtVF89_12100 OC=Legionellaceae; Legionella.
Sequence
MKHRHAKLIPASMWHDNQLFYEVLDESVLSIMKAKTSKDAISLLVKYLPKLNDQWKKKQA
WLGIALTQLENFSILLESAKILGFSKNNLFSLFAILGNVKFLNEYAKESGNDGILEMIKD
NQFYPYKKAAEHGNLDVLTCLETWASSQILEMILANDFYAYKQAAHNGHINVIKHLETKA
PGYILQMIQAQDYYGFRLGASGGHIELLKHMQSKAPQLFDKMVAANNFFAYRASLENGHF
EVSNWLLSNSSSCLAYAEAHRHEYGTTSVNPFIENRLAVLHREAINLPPPAVFDIQDTEQ
AKICFYMIRNLIRRNERNLDDEIKFLLNIPSVKALAHTVVTPNQPNELIRLALTTGNHEA
ASILLNIPEVRVLSEENDFYRDEVNGKLDLAQLSRDSESSMTSLTKGEKTRLNEAIKRYR
PTLESVGTAKLMQALRDQLKERYMANPASIINEEGRTIILPMDFEEFKQIKLSKKDYELA
LKSYFQNKNHTAWRYLAKPNPWMHPEAEYIYIDKLTSAKWSTFEEYQPLIAMLWLAATDK
EAEPTDGHTIESRLDHFVEELALIGRSHNWDKTRINSKNQQEEYDDLEGDRPSCYSGVKR
RLFQSVLGHPLITILTEDMVLEEIRTFARQHFQLFISEAKKAALKEAFDDYIVNINEIST
TSKELLISMNIPPEKQEEFEGYLSKKYGAQYTEDFAFISIVRNKLSLSSDKTDFFGNCHA
LMLDGNVGLYQMLENTGELKTDSNLSGVRTSQIGFFKHKKEETIADFCDEAPSPPSPEI
Download sequence
Identical sequences A0A133X096
WP_050598229.1.100653 WP_050598229.1.14160 WP_050598229.1.22644 WP_050598229.1.33239 WP_050598229.1.39047 WP_050598229.1.41771 WP_050598229.1.58394 WP_050598229.1.66871 WP_050598229.1.69425 WP_050598229.1.74594 WP_050598229.1.90390 WP_050598229.1.94812 WP_050598229.1.96607 WP_050598229.1.97854 WP_050598229.1.99517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]