SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A133X3H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A133X3H5
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 1.83e-88
Family Pseudo ankyrin repeat 0.000000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A133X3H5
Sequence length 333
Comment (tr|A0A133X3H5|A0A133X3H5_LEGPN) Ankyrin {ECO:0000313|EMBL:KXB25488.1} KW=Complete proteome OX=446 OS=Legionella pneumophila. GN=BJK08_11960 OC=Legionellaceae; Legionella.
Sequence
MFDLTIHNMENYENDPQLRLIPWILWENLFQHFISVYELSLMTLSYKEAIHIFLPRTKNM
EQVRQLLCLYYAHFDRNSKQFWNDVHSKGIKSEVICFVAAITGCLNALDTISLSLIPDEI
VKMIQAENYQAFRLAAENGHLHVINHLCELAPTEVTAMIQAENYYAFRWAAVGIGHHDVI
NFLLDSPVMLAYAKIHEFEYGEKYVNPFITSHVNRLKEMRDAFKQSNLDGVFDLVTKSGC
LEGFYMLRNLIRRNDEALLDDIRFLLSIPGIKALAPAGTIPGDENELLRLALRLGNQGAC
ELLLSIPDVLALTKANNYYIDETGGRLDLRAVA
Download sequence
Identical sequences A0A133X3H5
WP_027227455.1.100653 WP_027227455.1.14160 WP_027227455.1.22644 WP_027227455.1.33239 WP_027227455.1.39047 WP_027227455.1.41771 WP_027227455.1.66871 WP_027227455.1.69425 WP_027227455.1.74594 WP_027227455.1.90390 WP_027227455.1.94812 WP_027227455.1.96607 WP_027227455.1.97854 WP_027227455.1.99517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]