SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A134AC14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A134AC14
Domain Number 1 Region: 13-54
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.000000000144
Family Copper amine oxidase, domain N 0.013
Further Details:      
 
Domain Number 2 Region: 85-129
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.0000000144
Family Copper amine oxidase, domain N 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A134AC14
Sequence length 254
Comment (tr|A0A134AC14|A0A134AC14_9FIRM) Copper amine oxidase domain protein {ECO:0000313|EMBL:KXB65263.1} KW=Complete proteome; Reference proteome OX=755172 OS=Peptoniphilus coxii. GN=HMPREF1863_01773 OC=Peptoniphilus.
Sequence
MSTPSYAQQAIKLWVNGRYVSTDVPPVIENGRTLVPLRVISENLGIKVEWRADTRSVYTY
GEINGAPDFSNALLLTVGDKKVLKPANESAKTGSLYYNLEAAPSIINGRTMVPIRFIAEA
YKLKVDWDAINRTVIVGNGYTAPKKPSIPKKKVTREYSVALKKAQEYLQFMPFSKQGLFD
QLTSDYGEKFPADAAQYAVDHVTTDWNKNALRAAMTYRNEMHMSSRGIYDQLISSYGDQY
TEVQAKYAIDHLPN
Download sequence
Identical sequences A0A134AC14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]