SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135LE02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135LE02
Domain Number 1 Region: 141-278
Classification Level Classification E-value
Superfamily ISP domain 2.23e-38
Family Rieske iron-sulfur protein (ISP) 0.00000388
Further Details:      
 
Domain Number 2 Region: 96-153
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 2.11e-17
Family ISP transmembrane anchor 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A135LE02
Sequence length 280
Comment (tr|A0A135LE02|A0A135LE02_PENPA) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} KW=Complete proteome; Reference proteome OX=5078 OS=Penicillium patulum (Penicillium griseofulvum). GN=PGRI_010530 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MTGPVIPIASESSGSNFNFRLHPPSILTSPQLAAQFPPWSIVLTMSLSSASSTLLRTVAR
QQLPTARAAVTSCQRRGVADAKSSFQSPFATANEAGSTLKIPDFSKYKSKNSARSNQVFS
YFMAGSLGLASAVGAKATVQDFLVNMSASADVLAQAKVEIALGSIPEGKNVIIKWRGKPV
FIRHRTQAEIDEARESKWEGLRDPQPDEDRVQRPEWLVMLGVCTHLGCVPIGEAGDYGGW
FCPCHGSHYDISGRIRKGPAPLNLEVPVYSFPEEETLVIG
Download sequence
Identical sequences A0A135LE02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]