SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135LGK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135LGK2
Domain Number 1 Region: 29-198
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.45e-20
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00039
Further Details:      
 
Domain Number 2 Region: 397-509
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000114
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A135LGK2
Sequence length 592
Comment (tr|A0A135LGK2|A0A135LGK2_PENPA) Flavoprotein {ECO:0000313|EMBL:KXG48089.1} KW=Complete proteome; Reference proteome OX=5078 OS=Penicillium patulum (Penicillium griseofulvum). GN=PGRI_019590 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MEIDGVCDETVIGNKAVENATPSQLRRRRLLLSTDSAFASTVLPSLVQNPYVELRLITDE
PSALLTGTNKIPHYMDTVDSQTFDKKTCARKWLKAKTAELCEWADMLLVAPIDAGTLGAM
LAGLTNTLTLALLRGWVSDKPVVLIPGMTVSEWEHPLSTRQLDEISRHWPWIRTVKPVLW
KSNGPEDLTILPWDGLKELHQTLETTLKLPPWAATLSNTATTHGATVPAKTTSKSTSGSA
TGSTPQTKHTGNADFLPLEIWLNVFEDQLRDWETAKAVGIPTHLPVPQEWQSHLPKMSTT
ASLEYTILRGSFAAIKKRIDALPRWKPLSDLACHLIVKFSRTDILSYLTENHLDLLWTTS
RLTNIPYRASAIYGNPKVLTWWRDAPALPNKEYMADAMDGASRAGFVDVLDWWLHSGLPL
RYSERALEAASAEGRVAVLDWWKTASDNAPKSNPLPLKVGKSVLLAAQSGRTASLAWWDA
SGIPYSHAENVARIASTHGHVHVLEFWYKLKGPKMIFDNQVLVGPTKNGHDHVLQWWKSC
GLRVEFKTCDIEEALEDADPSSGAEGRVRRWWERNGLNLGVGTSEWMRSKVL
Download sequence
Identical sequences A0A135LGK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]