SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135LGL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135LGL6
Domain Number 1 Region: 507-597,672-703,1215-1256,1393-1480
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-33
Family Ankyrin repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 1061-1136,1225-1272
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000017
Family Pseudo ankyrin repeat 0.014
Further Details:      
 
Domain Number 3 Region: 679-781
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000255
Family Ankyrin repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 1573-1620
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000544
Family Ankyrin repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A135LGL6
Sequence length 1738
Comment (tr|A0A135LGL6|A0A135LGL6_PENPA) Uncharacterized protein {ECO:0000313|EMBL:KXG48078.1} KW=Complete proteome; Reference proteome OX=5078 OS=Penicillium patulum (Penicillium griseofulvum). GN=PGRI_019480 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MTSLPSLPVTHNDFVKYVNSNPEKPMRDLLQPYNEFDAILRKKFAQDPSHTSIQGNYVNI
VPLYDQKGSTDLSIRSRDLASETPEQTEKYLLPLSAEDRKPHGSAAVVLSLNEFQNNFAL
FTEGSLSDIDWSNVVAAGSAVVTSLLPVPEKYRNSKRGLRKYYHDEFAPASDVDLFLYGL
NEEQALEKIMHIEDKIKNTILYETTTIRTKNTITIASQYPNRHVQIVLRIYRSVAEILTG
FDVDASCAAYDGSQVYASPRAIAAYITQVNQIDLSRRSPSYENRLSKYSHRGFEVFWPAL
DRSKIDPTIFERSFTRTEGLARLLVLEKLPRSDDRDNYLQKRREERGRPPLDLYLRRRHG
KALHGNLKDDWEDEVPEWQEQDQVSDYHTFTIPYGRRFNARSIEKLLYTKDLLLNAQWNQ
PKDRAVYLHRHPAFFGEAEHVIGDCCGFCPKAVTEEEVKLAEEEAKIYISGNITFIKDDP
GRQEIGSFNPITETDWTEMAYVGQTEKLCQAIVANDVDSVKAFLAEEGTNPDRRDYTGRT
PLQLACMCSTPEVVQCLIDGGARMIPRMADGKTALHLAAARGHVEIIRILLKKSNENEEE
EATKQESLKKNDKSETKPSTDEDEDIEMIDQTDAMSHTSASYVKVDSEENEDLRTYDTLE
ENDLEPDVYDVNVVAWDSRAAPLHLAILHGHTEAVKELVASFGADILLPIKIMNEHYRTP
EAAILNLVLVHCLSSEKAKEMSHTLLNLGASPAQADLKQKTPLYYLAHSNKFDIMDIYMQ
HDEPAVKRAINHLVLKGSKWTPEFSSALMAAISAKSAPAAAKMLNAGAHPEIDLGELVKA
VKAAKGPHAYYGGTIEDEAKASVKQPILLAIDNDLPLVAIDLLNRGVDPNSDSTSIKERY
QDKGRTVLDVTRQILQTLREYLVGRKYPSHDLKTPLDPNDETYLSEFQSGSYKMFAAKDL
LRSVRKTNREIEANDKAESEKHDPPGLFEKKAVIAELIRDYEKLEFILLKKGAKTWDELH
PQEEVPVPAPAYVSTETKLPPPKPWEVTFNFNVPAITENARDGYLQLFEAAWNGDIDTIK
TLTLGKWGSLNDQEPLEIAVSDNQGLSALLISIMRGHLAVARAILQILHVQYKVKVSHGR
KRFEIDTDEYSNASDDDSDGENDSLNIVSDVVDDTFTYENIGEVTSQVESNTSPLSAFQA
QFNAFLFLDEYQDEESWDKRDKSPNIDSLLRYAVYKNNIPLLEFLLKTGLDLASTNPSGE
IEFSVRSKDFELAMSLGRTECLAKLIQMTGAGLPLAKLSDDCGVEDKKEPQYYPGLSIRG
AKRADWANAGRDQPMKAQSQRPPLLTAARQGNLAATEFFLGTAPARYYMEYLNSKKNDER
VKRLTQSKLGLEGTLLTWLQAKNNLVLHFAIMSEPSDETVRLVQYLVDQHPECMEARSTE
GLTPLAWAMSLHKVRFARILIKAGANQAARDKEARNLLHLILFSDTYRPCKNSNRFTRLT
DLLDKQLLQTMFMQRASGGLRTPFMAWLQAQTQFTPEDPVIPRPPNSPQTEDEILTSMTN
VILDLADSSQKHLELFDAGGNTPLHNAARKQFPQVLGLLLDRRPDMLYRENATGTTPMEM
VVDAWVNKCTAAPPVSPPASSATHPEWQHAVQRDPQFFIPGARVKYDKEKVMLRVCQERA
RERPGKRRLVSLFEANEVSKRLVAMGRTVRGAGNYNKPTGHNDDPEGWGSMYDMYSRW
Download sequence
Identical sequences A0A135LGL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]