SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135LXZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135LXZ6
Domain Number 1 Region: 24-80
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000000106
Family AN1-like Zinc finger 0.0034
Further Details:      
 
Domain Number 2 Region: 91-153
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000837
Family AN1-like Zinc finger 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A135LXZ6
Sequence length 320
Comment (tr|A0A135LXZ6|A0A135LXZ6_PENPA) Zinc finger, AN1-type {ECO:0000313|EMBL:KXG53846.1} KW=Complete proteome; Reference proteome OX=5078 OS=Penicillium patulum (Penicillium griseofulvum). GN=PGRI_008960 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MSPITVSKGRSPSSGPNETFTQMADTDLESLGRHCQYEYCGQLDFLPFRCESCRGTYCLD
HRTETAHQCPREGEWARRRNGTNTSHENRTAPEKPSIYNTDQCAHTQCKTLINTLKDPAV
RCPQCNHQYCLKHRLREEHDCAKITPLGARQHNAASPNDTIKSMFARVRTWGRDKQQAAA
KGTLLPTLPKMKPKPNSPAARAVAVNGLKRSAKGDASVPMDKRLYLHTVGTAETQAAEPP
AGDFFFDSRWKVGRVLDDAAKKLRVQNLNNRVDGEDSRLRIFHVESGEFLEFSEAIGAGK
VKQGDTIVLLRGAGAVLGSA
Download sequence
Identical sequences A0A135LXZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]