SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135P9L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135P9L1
Domain Number 1 Region: 8-195
Classification Level Classification E-value
Superfamily VC0467-like 3.53e-61
Family VC0467-like 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A135P9L1
Sequence length 195
Comment (tr|A0A135P9L1|A0A135P9L1_9RHIZ) UPF0301 protein ATO67_16260 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome OX=2052828 OS=Agrobacterium bohemicum. GN=ATO67_16260 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium.
Sequence
MDKKERGFLDGHFLIAMPGLEGGAFERSVVYICAHSDAGAIGFIINRAQQITFTDVLLHL
KMMDQNDAIMLPDRTRQFPIQCGGPVESGRGFVLHSDDYSSESSIPVSDDISLTSTLDIV
RAISGGRGPDKATMLLGYAGWGPGQLENEMVNNGWLNCPASEDLIFDRTLENKYERALGL
MGVDPRMLSAQAGHA
Download sequence
Identical sequences A0A135P9L1
WP_067651978.1.6705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]