SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135SAI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135SAI7
Domain Number 1 Region: 1247-1287,1718-1852
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.13e-20
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 1072-1393
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000269
Family Ankyrin repeat 0.0074
Further Details:      
 
Domain Number 3 Region: 491-537,578-597,635-760,790-817
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000782
Family Ankyrin repeat 0.0069
Further Details:      
 
Domain Number 4 Region: 1554-1670,1718-1785
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000034
Family Pseudo ankyrin repeat 0.021
Further Details:      
 
Domain Number 5 Region: 414-513
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000994
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A135SAI7
Sequence length 2195
Comment (tr|A0A135SAI7|A0A135SAI7_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KXH32777.1} KW=Complete proteome OX=703756 OS=Colletotrichum simmondsii. GN=CSIM01_04270 OC=Colletotrichum.
Sequence
MSDYLLSRVWATLGPRLGLGLEIQVEVSKTFGYSNGPFGPLLRSLTPSSSPLSVPSPPPF
PASLTSPPHTPPRFVRDLQRPRDRQRVRTRGPASRVGKSPSKFSKRKKREKDEQTKSLNS
TLLKRDALSPQGLGPRDTSTQLNLRPLLSALCPLDLRSFFADVFRAVCFASSFYLDTPKV
TTPASFNASAEGHGLRIVLLVAAACLLAASAAAGRQRTAVFSAVPLPLSVQHHLGTKTKP
CAARLSCLSLSSLSSAHVALRLTQPHSHESYPLTALSHPFPSFLSSPSSPSHASYGQVTA
VYHIAKLSPFLSSPPGSPPMPTPPTEDDRQRRIIQFAEEWGLEPPPSPTPLTRPSSPPSF
RTPEDDFKAEELLKRKQMSHGRTESTTNLRRAFTGKKKSWDYKVVFDTLDKHVADRGSPG
VAEALITQLVSSGGDVNMAQKAKTSILPRRKSLDSFGERSKLLQHAVHNGQIDMIQVLLP
HADTFALDASLPVAMQSENVEVVELLLRYGAGVAHSPEAQDSFRQACAAGGQADLVGIVL
RSEGRPPTSWLSQCMVDATKAGCLETVLQLSRSNADGDYNQAEALKVAISQGRHDIALAI
LMGNHPPKRPGLDEAFSNLLDHPSMNPRDKLAVAELLLCAGTDGDAPAMALIHAAAAEFQ
DMVSLLVKYGVSIEYQDAMAIRKAVQNGRVDVAHIILSGNAELSATHASECVELIPKNMG
VESRRLLLDLLLRRGANGTALHDMLIEAAEAGDVDSAKLLLTAVFPGGRPIAEHDVKKGP
RSMVYDRHQTASVDHKGGLALQIAVMRSDAAMAKELLMSKPSSDTLAQIFPLTKTLSRKN
RYRMVECFLTSGLAGPIVHDALQEAIDEEPPHRDEDLIGLFLKYNTDINTNEGSALVAAV
SQKDVRLLNALLKKNVTSHTAAGVLPRIIATQDAKARLDMATLLLTSVPDLDPVKVSQAM
LNALNYRPADLKLLQVLLVQGHADVNVDNGIAMASAIHSHDPPVLETLLMHGKPSHATVS
RAVSEFGQLIYSDTKAAKLEILLQKTKDRAPFNDVLVKEVHALLQTLPEHRQLSIVKVLL
SAGADVNSHNAAALCHAVAASDTQITDLLFAARPNPASLASALPHALRIADPMDRLEFSQ
KLLDAGAPSAEVNRALGFAINTYTNDIPLLRTLSAKANTSDGEALVSAVKKERPDIVQLV
LAQKHPLPVLNDAFAEAALLSNREARAAVCEVLLQHGASGSVLSDALLAAAADGDLVLGN
LLVSHGAQIDEDAIVEACRSGAADVLNMLLSGTTTPKRSTIERGFQAATEVGNLKTRAAI
LEPLLIHGVEGEALDAQLASAVRFGEEGDDLVKILLEAGADPNYNKGEAIWAATRSAYLS
SLKMMLGLVELGTRLVSKPSSASLRSIASAKSHASLKGSNKRKQHKPSHATLNRALRAAW
KLSREPRAAAIDMLFRAGLPISDDLHVVLNNAINEEELDLKIIRSLLRYGASPIANDCQT
LVDATRRALVKPLAFMLESKILSADLNLAIREGFTRENTDAWFSEAGFTILHSFLKKGAH
GDGLSSVLTQVVDLPLTESEPDSLALANGFVDILLDHKVDVNYADGKLLQSAAAACNSFL
VKRLLEKKPNTESISRSFYRIFDNPASEDDALELITMFTEYADGETRLDVMYTPPDSLPL
MFLALQQHPRSIRITKALLDAGYYYDQMMPCKVMEDLDEEAITLMMWALLQPQKKVSSGI
VQMLIETGAKVNFESKISQSTPLMLAIRNRRPDVVKMLLLEGAEVDVCDVKGNTPLTLST
EVGGDTAIKMMSNLLAAGASRNDGSLHNSARELNLSACQVLVQYGHEPDFPSTLHGGRSA
LGELARHCADNGELTAARQKLMERVINFLIEAGSDTTLRSEGKSILLLALESRDPLVTCR
TLLKAGMWKHINKKFNHYSDGKMTYSPTMYVMHVLPKSDQQDALIKLLRANRAEDVYYAN
MGPQPEGAVGMPEDVEAQERTRRARLDRINLEQEDHALSIARNRELATVQAQIWSAQAEL
EDSRRQRVAQDELVALNERARIEEDHFAAQMRRKRNERSADLEHQAALTEASITRARAVE
LAESDLTMARQSMMLEWEKQIATEKVDQAKTLSAIRVAEREDVDRLDREQEERFRARLAE
QRRLVDGQTNLASQLTNAGVNGRRQIGYITGEIRD
Download sequence
Identical sequences A0A135SAI7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]