SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135SWL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135SWL4
Domain Number 1 Region: 28-96
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 1.44e-28
Family Hydrophobin II, HfbII 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A135SWL4
Sequence length 98
Comment (tr|A0A135SWL4|A0A135SWL4_9PEZI) Fungal hydrophobin {ECO:0000313|EMBL:KXH40266.1} KW=Complete proteome OX=703756 OS=Colletotrichum simmondsii. GN=CSIM01_06443 OC=Colletotrichum.
Sequence
MRFTIAITALFAGVALSAPLEERQAVYVPCSGLYGTSQCCATDVLGVADLDCGNPPEAPT
SADEFSSICSAIGQRARCCVLPILDQGVLCNTPTGVSD
Download sequence
Identical sequences A0A135SWL4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]