SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135TR06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A135TR06
Domain Number - Region: 8-55
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.0628
Family FAD-dependent thiol oxidase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A135TR06
Sequence length 110
Comment (tr|A0A135TR06|A0A135TR06_9PEZI) Protein yippee-like {ECO:0000256|RuleBase:RU110713} KW=Complete proteome OX=703756 OS=Colletotrichum simmondsii. GN=CSIM01_12311 OC=Colletotrichum.
Sequence
MGLAYNTYLNSNKVYGCKTCKAHLSNHEDIISRNFRGQHGKAYLFNSVVNIETGEPSERN
MTTGRHIVRDITCKQCKETVGWKYDKAYEATEKYKEGKFILEAELLCNVT
Download sequence
Identical sequences A0A010RLP8 A0A135TR06 A0A1G4BGR6
XP_007603303.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]