SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135V271 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135V271
Domain Number 1 Region: 28-210
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 9.42e-28
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00029
Further Details:      
 
Domain Number 2 Region: 397-505
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000288
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A135V271
Sequence length 599
Comment (tr|A0A135V271|A0A135V271_9PEZI) Flavoprotein {ECO:0000313|EMBL:KXH66719.1} KW=Complete proteome; Reference proteome OX=1209931 OS=Colletotrichum salicis. GN=CSAL01_11353 OC=Colletotrichum.
Sequence
MDPPDPLPLRITRSASSSSSLHFKPRDRKLHLLVAANGPRDISWAQALVVRLSKTSAIEM
RAIVDDAVPRLSQTVITMQNRSMTLPLGPSRAGSEADVDDIEFYRQQAFELVEWADLLVL
APIDADNIAKMMVGIADTFLLEVLRGWDTTKKVLLVPGMSTHMWENPVTKRQLNKINSKW
PWIRAMPPILWHYDSSHKHPKRIVNWNGFNDVLGIIKNQADLLGLGRDVDVVTHLGYLAS
GDPRVYSNLPPEIWTIILDFADDWELAQALGIFTNIPMPYPWKLQPRNPNDPLKVYEHEL
EWLVLTGDSTSICKKLLQSPPTFHELPALVIKLLIRFSLIEVLTWMEANRPDLFQAFDGK
VLATKASAYFGRPDVLDYWKESRNFRGRHQQCYDAEVLDGASKNGYIQILDWWWRRSGLP
LRFTEAALEQASGKGHLLVLEWWRDAAAQDENIVLRPGKSLLWAAQHGQVDVIRWWVASG
IPVANGDAVAKIASRWGQVGVLELWRKLKGDDKLAFDGEVLVQPTIHQHIGVLEWWRKFA
YGELEGMEGRKHRVEYRTCDIEEALEDSIGDQEPVRKWWAGNGLNLSIRNLEWMRPRYL
Download sequence
Identical sequences A0A135V271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]