SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A136IYT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A136IYT1
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily Mannose-binding lectins 0.0000000000000942
Family Mannose-binding lectins 0.0056
Further Details:      
 
Domain Number 2 Region: 126-264
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0000471
Family ETX/MTX2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A136IYT1
Sequence length 329
Comment (tr|A0A136IYT1|A0A136IYT1_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KXJ89916.1} KW=Complete proteome; Reference proteome OX=196109 OS=Microdochium bolleyi. GN=Micbo1qcDRAFT_177101 OC=Microdochium.
Sequence
MVSEFIVGTGTVGGDNGRIFSETRFDGNENRSLVKYLEVWTTKDCLAGILVEYTDGYRAR
NGNLWGEMKSITLAPGETITSLGLYDNGNKTRCGGLRLTTSRNQTLSHTAGSNFKEHSQT
CHSGLMAGIYGKADVDIDRLGFYFLKDIANLSITIEDKDWIDSPVGTDKSISSATLAVAE
YGNSGPADTTYSFSGEKTITNSRTFTQSSTSTWGLNVQISASIFEIGIKGEASWSLSKMT
SNATTFTESSTVGTTISGTLKPGIAIKCATLCEFGALDIKYKSHVVVAFKDGQRLEFTEP
GVFKNALYANARTVVSRVNEAKGEAEESR
Download sequence
Identical sequences A0A136IYT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]