SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A137NZP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A137NZP5
Domain Number 1 Region: 59-115
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000432
Family AN1-like Zinc finger 0.0018
Further Details:      
 
Domain Number 2 Region: 5-51
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000127
Family AN1-like Zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A137NZP5
Sequence length 268
Comment (tr|A0A137NZP5|A0A137NZP5_CONC2) Uncharacterized protein {ECO:0000313|EMBL:KXN68178.1} KW=Complete proteome; Reference proteome OX=796925 OS=(Delacroixia coronata). GN=CONCODRAFT_9608 OC=Entomophthoromycetes; Entomophthorales; Ancylistaceae; Conidiobolus.
Sequence
MELSHIGDNCQSTICKQLDFLPFYCTTCELTFCQEHFISNEHPCSQLTKTVEFPTVRSST
KIPCNYQNCPVKELLAVYCKYCKNFYCVSHRSFLDHKCEGKKQEEVKKLEIKEETLSKIQ
KIAELTSKNEVPLQKPKTAVKKQSPLVKLMLIKQKAKGDTSIQPPNRFYFNLILPKSHLK
HNTPFPSYVHSDWIIGKLIDKLSSSNNVTNNRLNKNDKEMINLFNGETGEKLEISMKIKD
VKDFKQGNTLILEYSESDRVDLNEYDNV
Download sequence
Identical sequences A0A137NZP5
jgi|Conco1|9608|gm1.7848_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]