SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A137QEY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A137QEY0
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 3.14e-18
Family Nucleolar RNA-binding protein Nop10-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A137QEY0
Sequence length 73
Comment (tr|A0A137QEY0|A0A137QEY0_9AGAR) H/ACA ribonucleoprotein complex subunit 3 {ECO:0000313|EMBL:KXN85766.1} KW=Complete proteome; Reference proteome OX=1714833 OS=Leucoagaricus sp. SymC.cos. GN=AN958_10949 OC=Leucoagaricus.
Sequence
MHLMYTLDENGNRVYTLKIICAHTILQKITDDGKLTKSAHPARFSPDDKFSRHRVTIKKR
YGVLLTQLSAKPL
Download sequence
Identical sequences A0A137QEY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]